APOBEC3B anticorps (N-Term)
-
- Antigène Voir toutes APOBEC3B Anticorps
- APOBEC3B (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 3B (APOBEC3B))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp APOBEC3B est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ApoBEC3 B antibody was raised against the N terminal of APOBEC3
- Purification
- Affinity purified
- Immunogène
- ApoBEC3 B antibody was raised using the N terminal of APOBEC3 corresponding to a region with amino acids NQLPAYKCFQITWFVSWTPCPDCVAKLAEFLSEHPNVTLTISAARLYYYW
- Top Product
- Discover our top product APOBEC3B Anticorps primaire
-
-
- Indications d'application
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ApoBEC3B Blocking Peptide, catalog no. 33R-6841, is also available for use as a blocking control in assays to test for specificity of this ApoBEC3B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APOBEC0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- APOBEC3B (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 3B (APOBEC3B))
- Autre désignation
- ApoBEC3B (APOBEC3B Produits)
- Synonymes
- anticorps A3B, anticorps APOBEC1L, anticorps ARCD3, anticorps ARP4, anticorps DJ742C19.2, anticorps PHRBNL, anticorps bK150C2.2, anticorps APOBEC3B, anticorps Apobec3, anticorps Apobec3f, anticorps APOBEC3F, anticorps APOBEC3Z2, anticorps APOBEC3Z3, anticorps apolipoprotein B mRNA editing enzyme catalytic subunit 3B, anticorps APOBEC3B, anticorps Apobec3b
- Sujet
- APOBEC3B is a member of the cytidine deaminase family. It is thought that these proteins may be RNA editing enzymes and have roles in growth or cell cycle control.
- Poids moléculaire
- 46 kDa (MW of target protein)
-