ZCRB1 anticorps (N-Term)

N° du produit ABIN633544

Détail du produit anti-ZCRB1 anticorps

Antigène: ZCRB1 (Zinc Finger CCHC-Type and RNA Binding Motif 1 (ZCRB1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ZCRB1 est non-conjugé

Application: Western Blotting (WB)

Specificité: ZCRB1 antibody was raised against the N terminal of ZCRB1

Purification: Affinity purified

Immunogène: ZCRB1 antibody was raised using the N terminal of ZCRB1 corresponding to a region with amino acids MSGGLAPSKSTVYVSNLPFSLTNNDLYRIFSKYGKVVKVTIMKDKDTRKS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ZCRB1 Blocking Peptide, catalog no. 33R-6428, is also available for use as a blocking control in assays to test for specificity of this ZCRB1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZCRB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ZCRB1

Antigène: ZCRB1 (Zinc Finger CCHC-Type and RNA Binding Motif 1 (ZCRB1))

Autre désignation: ZCRB1 (ZCRB1 Produits)

Synonymes: anticorps MADP-1, anticorps madp1, anticorps rbm36, anticorps madp-1, anticorps zcchc19, anticorps MADP1, anticorps RBM36, anticorps SNRNP31, anticorps ZCCHC19, anticorps 2700088M22Rik, anticorps Madp-1, anticorps RGD1309851, anticorps si:ch211-155a11.4, anticorps zgc:110711, anticorps zinc finger CCHC-type and RNA binding motif containing 1, anticorps zinc finger CCHC-type and RNA binding motif 1, anticorps zinc finger CCHC-type and RNA binding motif containing 1 L homeolog, anticorps ZCRB1, anticorps zcrb1, anticorps Zcrb1, anticorps zcrb1.L

Sujet: Pre-mRNA splicing is catalyzed by the spliceosome. U12-type spliceosome binds U12-type pre-mRNAs and recognises the 5' splice site and branch-point sequence.

Poids moléculaire: 24 kDa (MW of target protein)