RPUSD3 anticorps (Middle Region)

N° du produit ABIN633554

Détail du produit anti-RPUSD3 anticorps

Antigène: RPUSD3 (RNA Pseudouridylate Synthase Domain Containing 3 (RPUSD3))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RPUSD3 est non-conjugé

Application: Western Blotting (WB)

Specificité: RPUSD3 antibody was raised against the middle region of RPUSD3

Purification: Affinity purified

Immunogène: RPUSD3 antibody was raised using the middle region of RPUSD3 corresponding to a region with amino acids MVLQLCPVLGDHMYSARVGTVLGQRFLLPAENNKPQRQVLDEALLRRLHL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RPUSD3 Blocking Peptide, catalog no. 33R-6594, is also available for use as a blocking control in assays to test for specificity of this RPUSD3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPUSD3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RPUSD3

Antigène: RPUSD3 (RNA Pseudouridylate Synthase Domain Containing 3 (RPUSD3))

Autre désignation: RPUSD3 (RPUSD3 Produits)

Synonymes: anticorps AI527266, anticorps RGD1307582, anticorps RNA pseudouridylate synthase domain containing 3, anticorps RPUSD3, anticorps Rpusd3

Sujet: The specific function of RPUSD3 is not yet known.

Poids moléculaire: 37 kDa (MW of target protein)