EIF3G anticorps (Middle Region)

N° du produit ABIN633566

Détail du produit anti-EIF3G anticorps

Antigène: EIF3G (Eukaryotic Translation Initiation Factor 3, Subunit G (EIF3G))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EIF3G est non-conjugé

Application: Western Blotting (WB)

Specificité: EIF3 G antibody was raised against the middle region of EIF3

Purification: Affinity purified

Immunogène: EIF3 G antibody was raised using the middle region of EIF3 corresponding to a region with amino acids LRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EIF3G Blocking Peptide, catalog no. 33R-5350, is also available for use as a blocking control in assays to test for specificity of this EIF3G antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EIF3G

Antigène: EIF3G (Eukaryotic Translation Initiation Factor 3, Subunit G (EIF3G))

Autre désignation: EIF3G (EIF3G Produits)

Synonymes: anticorps EIF3-P42, anticorps EIF3S4, anticorps eIF3-delta, anticorps eIF3-p44, anticorps 44kDa, anticorps D0Jmb4, anticorps Eif3s4, anticorps TU-189B2, anticorps p44, anticorps eif3s4, anticorps zgc:56553, anticorps eIF3g-A, anticorps eif3s4-A, anticorps eIF3g, anticorps eIF3-S4, anticorps An16g05260, anticorps AO090011000648, anticorps eukaryotic translation initiation factor 3 subunit G, anticorps eukaryotic translation initiation factor 3, subunit G, anticorps eukaryotic translation initiation factor 3 subunit G S homeolog, anticorps Eukaryotic translation initiation factor 3 subunit G, anticorps eukaryotic translation initiation factor, anticorps EIF3G, anticorps Eif3g, anticorps eif3g, anticorps eif3g.S, anticorps eif-3.G, anticorps eIF3g, anticorps ANI_1_732144, anticorps AOR_1_1112054, anticorps VDBG_00824, anticorps MGYG_08099, anticorps Tsp_04379

Sujet: EIF3G belongs to the eIF-3 subunit G family. It is a component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis.

Poids moléculaire: 35 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization