STAU1/Staufen anticorps

N° du produit ABIN633583

Détail du produit anti-STAU1/Staufen anticorps

Antigène: STAU1/Staufen (STAU1) (Staufen Double-Stranded RNA Binding Protein 1 (STAU1))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp STAU1/Staufen est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: STAU1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NFEVARESGPPHMKNFVTKVSVGEFVGEGEGKSKKISKKNAAIAVLEELK

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

STAU1 Blocking Peptide, catalog no. 33R-6681, is also available for use as a blocking control in assays to test for specificity of this STAU1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STAU1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur STAU1/Staufen

Antigène: STAU1/Staufen (STAU1) (Staufen Double-Stranded RNA Binding Protein 1 (STAU1))

Autre désignation: STAU1 (STAU1 Produits)

Synonymes: anticorps STAU1, anticorps DKFZp459A0124, anticorps CG5753, anticorps Dmel\\CG5753, anticorps Dmstau, anticorps STAU, anticorps Stau, anticorps Stauf, anticorps dStau, anticorps stau, anticorps XStau, anticorps XStau1, anticorps Staufen, anticorps Staufen1, anticorps MGC145034, anticorps 5830401L18Rik, anticorps AW549911, anticorps C85792, anticorps fi67e05, anticorps wu:fi67e05, anticorps zgc:77271, anticorps staufen double-stranded RNA binding protein 1, anticorps staufen, anticorps RNA binding protein homolog, anticorps staufen (RNA binding protein) homolog 1 (Drosophila), anticorps staufen double-stranded RNA binding protein 1 L homeolog, anticorps STAU1, anticorps stau, anticorps stau1, anticorps STAUFEN, anticorps Stau1, anticorps stau1.L

Sujet: STAU1(Staufen) is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind RNAs having double-stranded secondary structures.

Poids moléculaire: 35 kDa (MW of target protein)

Pathways: Asymmetric Protein Localization