EIF4E3 anticorps (Middle Region)

N° du produit ABIN633584

Détail du produit anti-EIF4E3 anticorps

Antigène: EIF4E3 (Eukaryotic Translation Initiation Factor 4E Family Member 3 (EIF4E3))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EIF4E3 est non-conjugé

Application: Western Blotting (WB)

Specificité: EIF4 E3 antibody was raised against the middle region of EIF4 3

Purification: Affinity purified

Immunogène: EIF4 E3 antibody was raised using the middle region of EIF4 3 corresponding to a region with amino acids VQVWNVNASLVGEATVLEKIYELLPHITFKAVFYKPHEEHHAFEGGRGKH

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EIF4E3 Blocking Peptide, catalog no. 33R-9766, is also available for use as a blocking control in assays to test for specificity of this EIF4E3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EIF4E3

Antigène: EIF4E3 (Eukaryotic Translation Initiation Factor 4E Family Member 3 (EIF4E3))

Autre désignation: EIF4E3 (EIF4E3 Produits)

Synonymes: anticorps eif4e3, anticorps wu:fc31f11, anticorps wu:fd15f11, anticorps zgc:92189, anticorps DDBDRAFT_0191035, anticorps DDBDRAFT_0234256, anticorps DDB_0191035, anticorps DDB_0234256, anticorps IF4E3, anticorps 1300018P11Rik, anticorps AI451927, anticorps eIF4E-3, anticorps eukaryotic translation initiation factor 4E family member 3, anticorps eukaryotic translation initiation factor 4E family member 3 L homeolog, anticorps eukaryotic translation initiation factor 4E member 3, anticorps eukaryotic translation initiation factor 4E family member 3 S homeolog, anticorps EIF4E3, anticorps Eif4e3, anticorps eif4e3.L, anticorps eif4e3, anticorps eIF4e3, anticorps eif4e3.S

Sujet: EIF4E3 belongs to the EIF4E family of translational initiation factors that interact with the 5-prime cap structure of mRNA and recruit mRNA to the ribosome.

Poids moléculaire: 24 kDa (MW of target protein)