IGF2BP1 anticorps (Middle Region)
-
- Antigène Voir toutes IGF2BP1 Anticorps
- IGF2BP1 (Insulin-Like Growth Factor 2 mRNA Binding Protein 1 (IGF2BP1))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp IGF2BP1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- IGF2 BP1 antibody was raised against the middle region of IGF2 P1
- Purification
- Affinity purified
- Immunogène
- IGF2 BP1 antibody was raised using the middle region of IGF2 P1 corresponding to a region with amino acids YKDRRRRAHTQAEQKRRDAIKRGYDDLQTIVPTCQQQDFSIGSQKLSKAI
- Top Product
- Discover our top product IGF2BP1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
IGF2BP1 Blocking Peptide, catalog no. 33R-10146, is also available for use as a blocking control in assays to test for specificity of this IGF2BP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IGF0 P1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- IGF2BP1 (Insulin-Like Growth Factor 2 mRNA Binding Protein 1 (IGF2BP1))
- Autre désignation
- IGF2BP1 (IGF2BP1 Produits)
- Synonymes
- anticorps IGF2BP1, anticorps ZBP1, anticorps CRD-BP, anticorps CRDBP, anticorps IMP-1, anticorps IMP1, anticorps VICKZ1, anticorps AL024068, anticorps AW549074, anticorps Crdbp, anticorps D030026A21Rik, anticorps D11Moh40e, anticorps D11Moh45, anticorps Neilsen, anticorps Zbp1, anticorps Imp1, anticorps wu:fi72a06, anticorps zgc:152963, anticorps insulin like growth factor 2 mRNA binding protein 1, anticorps insulin-like growth factor 2 mRNA binding protein 1, anticorps IGF2BP1, anticorps Igf2bp1, anticorps igf2bp1
- Sujet
- IGF2BP1 is a member of the IGF-II mRNA-binding protein (IMP) family. The protein contains four K homology domains and two RNA recognition motifs. It functions by binding to the 5' UTR of the insulin-like growth factor 2 (IGF2) mRNA and regulating IGF2 translation.
- Poids moléculaire
- 63 kDa (MW of target protein)
-