VDAC2 anticorps (N-Term)

N° du produit ABIN633625

Détail du produit anti-VDAC2 anticorps

Antigène: VDAC2 (Voltage-Dependent Anion Channel 2 (VDAC2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp VDAC2 est non-conjugé

Application: Western Blotting (WB)

Specificité: VDAC2 antibody was raised against the N terminal of VDAC2

Purification: Affinity purified

Immunogène: VDAC2 antibody was raised using the N terminal of VDAC2 corresponding to a region with amino acids VKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

VDAC2 Blocking Peptide, catalog no. 33R-9629, is also available for use as a blocking control in assays to test for specificity of this VDAC2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VDAC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur VDAC2

Antigène: VDAC2 (Voltage-Dependent Anion Channel 2 (VDAC2))

Autre désignation: VDAC2 (VDAC2 Produits)

Synonymes: anticorps POR, anticorps Vdac6, anticorps mVDAC2, anticorps mVDAC6, anticorps wu:fa01a08, anticorps wu:fa98a10, anticorps wu:fb50g11, anticorps zgc:55795, anticorps zgc:77621, anticorps vdac2, anticorps VDAC2, anticorps ARABIDOPSIS THALIANA VOLTAGE DEPENDENT ANION CHANNEL 2, anticorps ATVDAC2, anticorps K9I9.6, anticorps K9I9_6, anticorps voltage dependent anion channel 2, anticorps voltage dependent anion channel 2, anticorps voltage-dependent anion channel 2, anticorps voltage-dependent anion channel 2 S homeolog, anticorps VDAC2, anticorps Vdac2, anticorps vdac2, anticorps vdac2.S

Sujet: VDAC2 forms a channel through the mitochondrial outer membrane that allows diffusion of small hydrophilic molecules. The channel adopts an open conformation at low or zero membrane potential and a closed conformation at potentials above 30-40 mV. The open state has a weak anion selectivity whereas the closed state is cation-selective.

Poids moléculaire: 31 kDa (MW of target protein)