VDAC2 anticorps (N-Term)
-
- Antigène Voir toutes VDAC2 Anticorps
- VDAC2 (Voltage-Dependent Anion Channel 2 (VDAC2))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp VDAC2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- VDAC2 antibody was raised against the N terminal of VDAC2
- Purification
- Affinity purified
- Immunogène
- VDAC2 antibody was raised using the N terminal of VDAC2 corresponding to a region with amino acids VKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWN
- Top Product
- Discover our top product VDAC2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
VDAC2 Blocking Peptide, catalog no. 33R-9629, is also available for use as a blocking control in assays to test for specificity of this VDAC2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VDAC2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- VDAC2 (Voltage-Dependent Anion Channel 2 (VDAC2))
- Autre désignation
- VDAC2 (VDAC2 Produits)
- Synonymes
- anticorps POR, anticorps Vdac6, anticorps mVDAC2, anticorps mVDAC6, anticorps wu:fa01a08, anticorps wu:fa98a10, anticorps wu:fb50g11, anticorps zgc:55795, anticorps zgc:77621, anticorps vdac2, anticorps VDAC2, anticorps ARABIDOPSIS THALIANA VOLTAGE DEPENDENT ANION CHANNEL 2, anticorps ATVDAC2, anticorps K9I9.6, anticorps K9I9_6, anticorps voltage dependent anion channel 2, anticorps voltage dependent anion channel 2, anticorps voltage-dependent anion channel 2, anticorps voltage-dependent anion channel 2 S homeolog, anticorps VDAC2, anticorps Vdac2, anticorps vdac2, anticorps vdac2.S
- Sujet
- VDAC2 forms a channel through the mitochondrial outer membrane that allows diffusion of small hydrophilic molecules. The channel adopts an open conformation at low or zero membrane potential and a closed conformation at potentials above 30-40 mV. The open state has a weak anion selectivity whereas the closed state is cation-selective.
- Poids moléculaire
- 31 kDa (MW of target protein)
-