CACNB4 anticorps (Middle Region)

N° du produit ABIN633638

Détail du produit anti-CACNB4 anticorps

Antigène: CACNB4 (Calcium Channel, Voltage-Dependent, beta 4 Subunit (CACNB4))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CACNB4 est non-conjugé

Application: Western Blotting (WB)

Specificité: CACNB4 antibody was raised against the middle region of CACNB4

Purification: Affinity purified

Immunogène: CACNB4 antibody was raised using the middle region of CACNB4 corresponding to a region with amino acids GVPDPGTGASSGTRTPDVKAFLESPWSLDPASASPEPVPHILASSRQWDP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CACNB4 Blocking Peptide, catalog no. 33R-3649, is also available for use as a blocking control in assays to test for specificity of this CACNB4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CACNB4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CACNB4

Antigène: CACNB4 (Calcium Channel, Voltage-Dependent, beta 4 Subunit (CACNB4))

Autre désignation: CACNB4 (CACNB4 Produits)

Synonymes: anticorps CAB4, anticorps CACNLB4, anticorps EA5, anticorps EIG9, anticorps EJM, anticorps EJM4, anticorps EJM6, anticorps 3110038O15Rik, anticorps Cchb4, anticorps lethargic, anticorps lh, anticorps CACNB4, anticorps cacnb4.2, anticorps calcium voltage-gated channel auxiliary subunit beta 4, anticorps calcium channel, voltage-dependent, beta 4 subunit, anticorps calcium channel, voltage-dependent, beta 4a subunit, anticorps CACNB4, anticorps Cacnb4, anticorps cacnb4.1, anticorps cacnb4, anticorps cacnb4a

Sujet: CACNB4 is a member of the beta subunit family of voltage-dependent calcium channel complex proteins. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization and consist of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio. Various versions of each of these subunits exist, either expressed from similar genes or the result of alternative splicing. CACNB4 plays an important role in calcium channel function by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation. Certain mutations in this gene have been associated with idiopathic generalized epilepsy (IGE) and juvenile myoclonic epilepsy (JME).

Poids moléculaire: 50 kDa (MW of target protein)

Pathways: cAMP Metabolic Process, Skeletal Muscle Fiber Development