P2RX6 anticorps (N-Term)
-
- Antigène Voir toutes P2RX6 Anticorps
- P2RX6 (Purinergic Receptor P2X, Ligand-Gated Ion Channel, 6 (P2RX6))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp P2RX6 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- P2 RXL1 antibody was raised against the N terminal of P2 XL1
- Purification
- Affinity purified
- Immunogène
- P2 RXL1 antibody was raised using the N terminal of P2 XL1 corresponding to a region with amino acids NWRVGALQRLLQFGIVVYVVGWALLAKKGYQERDLEPQFSIITKLKGVSV
- Top Product
- Discover our top product P2RX6 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
P2RXL1 Blocking Peptide, catalog no. 33R-6932, is also available for use as a blocking control in assays to test for specificity of this P2RXL1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of P0 XL1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- P2RX6 (Purinergic Receptor P2X, Ligand-Gated Ion Channel, 6 (P2RX6))
- Autre désignation
- P2RXL1 (P2RX6 Produits)
- Synonymes
- anticorps P2RXL1, anticorps P2X6, anticorps P2XM, anticorps P2rxl1, anticorps P2x6, anticorps P2xm, anticorps Rnap2x6, anticorps purinergic receptor P2X 6, anticorps purinergic receptor P2X, ligand-gated ion channel, 6, anticorps P2X purinoceptor 6, anticorps P2RX6, anticorps P2rx6, anticorps LOC100051842, anticorps LOC100588488
- Sujet
- The protein encoded by this gene belongs to the family of P2X receptors, which are ATP-gated ion channels and mediate rapid and selective permeability to cations. This gene is predominantly expressed in skeletal muscle, and regulated by p53. The encoded protein is associated with VE-cadherin at the adherens junctions of human umbilical vein endothelial cells. Alternative splicing results in multiple transcript variants. A related pseudogene, which is also located on chromosome 22, has been identified.
- Poids moléculaire
- 49 kDa (MW of target protein)
-