P2RX6 anticorps (N-Term)

N° du produit ABIN633650

Détail du produit anti-P2RX6 anticorps

Antigène: P2RX6 (Purinergic Receptor P2X, Ligand-Gated Ion Channel, 6 (P2RX6))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp P2RX6 est non-conjugé

Application: Western Blotting (WB)

Specificité: P2 RXL1 antibody was raised against the N terminal of P2 XL1

Purification: Affinity purified

Immunogène: P2 RXL1 antibody was raised using the N terminal of P2 XL1 corresponding to a region with amino acids NWRVGALQRLLQFGIVVYVVGWALLAKKGYQERDLEPQFSIITKLKGVSV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

P2RXL1 Blocking Peptide, catalog no. 33R-6932, is also available for use as a blocking control in assays to test for specificity of this P2RXL1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of P0 XL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur P2RX6

Antigène: P2RX6 (Purinergic Receptor P2X, Ligand-Gated Ion Channel, 6 (P2RX6))

Autre désignation: P2RXL1 (P2RX6 Produits)

Synonymes: anticorps P2RXL1, anticorps P2X6, anticorps P2XM, anticorps P2rxl1, anticorps P2x6, anticorps P2xm, anticorps Rnap2x6, anticorps purinergic receptor P2X 6, anticorps purinergic receptor P2X, ligand-gated ion channel, 6, anticorps P2X purinoceptor 6, anticorps P2RX6, anticorps P2rx6, anticorps LOC100051842, anticorps LOC100588488

Sujet: The protein encoded by this gene belongs to the family of P2X receptors, which are ATP-gated ion channels and mediate rapid and selective permeability to cations. This gene is predominantly expressed in skeletal muscle, and regulated by p53. The encoded protein is associated with VE-cadherin at the adherens junctions of human umbilical vein endothelial cells. Alternative splicing results in multiple transcript variants. A related pseudogene, which is also located on chromosome 22, has been identified.

Poids moléculaire: 49 kDa (MW of target protein)