KCNH7 anticorps
-
- Antigène Voir toutes KCNH7 Anticorps
- KCNH7 (Potassium Voltage-Gated Channel, Subfamily H (Eag-Related), Member 7 (KCNH7))
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp KCNH7 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- KCNH7 antibody was raised using a synthetic peptide corresponding to a region with amino acids PILPIKTVNRKFFGFKFPGLRVLTYRKQSLPQEDPDVVVIDSSKHSDDSV
- Top Product
- Discover our top product KCNH7 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
KCNH7 Blocking Peptide, catalog no. 33R-7158, is also available for use as a blocking control in assays to test for specificity of this KCNH7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNH7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- KCNH7 (Potassium Voltage-Gated Channel, Subfamily H (Eag-Related), Member 7 (KCNH7))
- Autre désignation
- KCNH7 (KCNH7 Produits)
- Synonymes
- anticorps KCNH7, anticorps kcnh7, anticorps ERG3, anticorps HERG3, anticorps Kv11.3, anticorps 9330137I11Rik, anticorps erg3, anticorps potassium voltage-gated channel subfamily H member 7, anticorps potassium channel, voltage gated eag related subfamily H, member 7, anticorps potassium voltage-gated channel, subfamily H (eag-related), member 7, anticorps KCNH7, anticorps kcnh7, anticorps LOC100545485, anticorps Kcnh7
- Sujet
- Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. KCNH7 is a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit.
- Poids moléculaire
- 83 kDa (MW of target protein)
-