Tel:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@anticorps-enligne.fr

Potassium Voltage-Gated Channel, Subfamily G, Member 1 (KCNG1) (N-Term) anticorps Primary Antibody

KCNG1 Reactivité: Humain WB Hôte: Lapin Polyclonal unconjugated
N° du produit ABIN633688
$647.32
Plus shipping costs $45.00
50 μg
local_shipping Destination: Etats-Unis
Envoi sous 9 à 11 jours ouvrables
  • Antigène
    Potassium Voltage-Gated Channel, Subfamily G, Member 1 (KCNG1)
    Épitope
    N-Term
    • 3
    • 1
    • 1
    Reactivité
    Humain
    • 26
    • 22
    • 22
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    Hôte
    Lapin
    Clonalité
    Polyclonal
    Conjugué
    Inconjugué
    • 10
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Application
    Western Blotting (WB)
    • 13
    • 12
    • 5
    • 5
    • 4
    • 1
    • 1
    Specificité
    KCNG1 antibody was raised against the N terminal of KCNG1
    Purification
    Affinity purified
    Immunogène
    KCNG1 antibody was raised using the N terminal of KCNG1 corresponding to a region with amino acids MTLLPGDNSDYDYSALSCTSDASFHPAFLPQRQAIKGAFYRRAQRLRPQD
  • Indications d'application
    WB: 0.25 µg/mL
    Optimal conditions should be determined by the investigator.
    Commentaires

    KCNG1 Blocking Peptide, catalog no. 33R-6553, is also available for use as a blocking control in assays to test for specificity of this KCNG1 antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNG1 antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Conseil sur la manipulation
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Stock
    4 °C
    Stockage commentaire
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Antigène
    Potassium Voltage-Gated Channel, Subfamily G, Member 1 (KCNG1)
    Autre désignation
    KCNG1 (KCNG1 Antibody Extrait)
    Synonymes
    kcng1, MGC122787, K13, KCNG, KV6.1, kH2, AW536275, OTTMUSG00000016048, Kh2, Kv6.1, potassium channel, voltage gated modifier subfamily G, member 1, potassium voltage-gated channel modifier subfamily G member 1, potassium voltage-gated channel, subfamily G, member 1, kcng1, KCNG1, Kcng1
    Sujet
    Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. KCNG1 is a member of the potassium channel, voltage-gated, subfamily G.
    Poids moléculaire
    56 kDa (MW of target protein)
Vous êtes ici:
help Support technique