KCNG1 anticorps (N-Term)
-
- Antigène Voir toutes KCNG1 Anticorps
- KCNG1 (Potassium Voltage-Gated Channel, Subfamily G, Member 1 (KCNG1))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp KCNG1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- KCNG1 antibody was raised against the N terminal of KCNG1
- Purification
- Affinity purified
- Immunogène
- KCNG1 antibody was raised using the N terminal of KCNG1 corresponding to a region with amino acids YDVTCNEFFFDRNPGAFGTILTFLRAGKLRLLREMCALSFQEELLYWGIA
- Top Product
- Discover our top product KCNG1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
KCNG1 Blocking Peptide, catalog no. 33R-10077, is also available for use as a blocking control in assays to test for specificity of this KCNG1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNG1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- KCNG1 (Potassium Voltage-Gated Channel, Subfamily G, Member 1 (KCNG1))
- Autre désignation
- KCNG1 (KCNG1 Produits)
- Synonymes
- anticorps kcng1, anticorps MGC122787, anticorps K13, anticorps KCNG, anticorps KV6.1, anticorps kH2, anticorps AW536275, anticorps OTTMUSG00000016048, anticorps Kh2, anticorps Kv6.1, anticorps potassium channel, voltage gated modifier subfamily G, member 1, anticorps potassium voltage-gated channel modifier subfamily G member 1, anticorps potassium voltage-gated channel, subfamily G, member 1, anticorps kcng1, anticorps KCNG1, anticorps Kcng1
- Sujet
- Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. KCNG1 is a member of the potassium channel, voltage-gated, subfamily G. Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume.
- Poids moléculaire
- 58 kDa (MW of target protein)
-