Potassium Voltage-Gated Channel, Subfamily G, Member 1 (KCNG1) (N-Term) anticorps

N° du produit ABIN633693

Détail du produit

Antigène:

Potassium Voltage-Gated Channel, Subfamily G, Member 1 (KCNG1)

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB)

Specificité: KCNG1 antibody was raised against the N terminal of KCNG1

Purification: Affinity purified

Immunogène: KCNG1 antibody was raised using the N terminal of KCNG1 corresponding to a region with amino acids YDVTCNEFFFDRNPGAFGTILTFLRAGKLRLLREMCALSFQEELLYWGIA

Détail du antigène

Antigène:

Potassium Voltage-Gated Channel, Subfamily G, Member 1 (KCNG1)

Autre désignation: KCNG1 (KCNG1 Antibody Extrait)

Sujet: Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. KCNG1 is a member of the potassium channel, voltage-gated, subfamily G. Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume.

Poids moléculaire: 58 kDa (MW of target protein)

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KCNG1 Blocking Peptide, catalog no. 33R-10077, is also available for use as a blocking control in assays to test for specificity of this KCNG1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.