KCNH5 anticorps

N° du produit ABIN633694

Détail du produit anti-KCNH5 anticorps

Antigène: KCNH5 (Potassium Voltage-Gated Channel, Subfamily H (Eag-Related), Member 5 (KCNH5))

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KCNH5 est non-conjugé

Application: Immunohistochemistry (IHC), Western Blotting (WB)

Purification: Affinity purified

Immunogène: KCNH5 antibody was raised using a synthetic peptide corresponding to a region with amino acids LTNSRSVLQQLTPMNKTEVVHKHSRLAEVLQLGSDILPQYKQEAPKTPPH

Information d'application

Indications d'application: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KCNH5 Blocking Peptide, catalog no. 33R-5485, is also available for use as a blocking control in assays to test for specificity of this KCNH5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNH5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KCNH5

Antigène: KCNH5 (Potassium Voltage-Gated Channel, Subfamily H (Eag-Related), Member 5 (KCNH5))

Autre désignation: KCNH5 (KCNH5 Produits)

Sujet: Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. The KCNH5 gene encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit of a voltage-gated non-inactivating delayed rectifier potassium channel. KCNH5 is not expressed in differentiating myoblasts.

Poids moléculaire: 67 kDa (MW of target protein)