KCNH5 anticorps
-
- Antigène Voir toutes KCNH5 Anticorps
- KCNH5 (Potassium Voltage-Gated Channel, Subfamily H (Eag-Related), Member 5 (KCNH5))
-
Reactivité
- Humain, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp KCNH5 est non-conjugé
-
Application
- Immunohistochemistry (IHC), Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- KCNH5 antibody was raised using a synthetic peptide corresponding to a region with amino acids LTNSRSVLQQLTPMNKTEVVHKHSRLAEVLQLGSDILPQYKQEAPKTPPH
- Top Product
- Discover our top product KCNH5 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
KCNH5 Blocking Peptide, catalog no. 33R-5485, is also available for use as a blocking control in assays to test for specificity of this KCNH5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNH5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- KCNH5 (Potassium Voltage-Gated Channel, Subfamily H (Eag-Related), Member 5 (KCNH5))
- Autre désignation
- KCNH5 (KCNH5 Produits)
- Sujet
- Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. The KCNH5 gene encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit of a voltage-gated non-inactivating delayed rectifier potassium channel. KCNH5 is not expressed in differentiating myoblasts.
- Poids moléculaire
- 67 kDa (MW of target protein)
-