SCN8A anticorps (Middle Region)

N° du produit ABIN633702

Détail du produit anti-SCN8A anticorps

Antigène: SCN8A (Sodium Channel, Voltage-Gated, Type VIII, alpha (SCN8A))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SCN8A est non-conjugé

Application: Western Blotting (WB)

Specificité: SCN8 A antibody was raised against the middle region of SCN8

Purification: Affinity purified

Immunogène: SCN8 A antibody was raised using the middle region of SCN8 corresponding to a region with amino acids ESDPEGSKDKLDDTSSSEGSTIDIKPEVEEVPVEQPEEYLDPDACFTEGC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SCN8A Blocking Peptide, catalog no. 33R-2720, is also available for use as a blocking control in assays to test for specificity of this SCN8A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCN0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SCN8A

Antigène: SCN8A (Sodium Channel, Voltage-Gated, Type VIII, alpha (SCN8A))

Autre désignation: SCN8A (SCN8A Produits)

Synonymes: anticorps CERIII, anticorps CIAT, anticorps EIEE13, anticorps MED, anticorps NaCh6, anticorps Nav1.6, anticorps PN4, anticorps AI853486, anticorps C630029C19Rik, anticorps dmu, anticorps med, anticorps mnd-2, anticorps mnd2, anticorps nmf2, anticorps nmf335, anticorps nmf58, anticorps nur14, anticorps seal, anticorps sodium voltage-gated channel alpha subunit 8, anticorps sodium channel, voltage-gated, type VIII, alpha, anticorps SCN8A, anticorps Scn8a

Sujet: Voltage-dependent sodium channels, such as SCN8A, are responsible for the initial membrane depolarization that occurs during generation of action potentials in most electrically excitable cells.

Poids moléculaire: 225 kDa (MW of target protein)

Pathways: Sensory Perception of Sound