TRPC6 anticorps (Middle Region)

N° du produit ABIN633705

Détail du produit anti-TRPC6 anticorps

Antigène: TRPC6 (Transient Receptor Potential Cation Channel, Subfamily C, Member 6 (TRPC6))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TRPC6 est non-conjugé

Application: Western Blotting (WB)

Specificité: TRPC6 antibody was raised against the middle region of TRPC6

Purification: Affinity purified

Immunogène: TRPC6 antibody was raised using the middle region of TRPC6 corresponding to a region with amino acids KKGFQEDAEMNKINEEKKLGILGSHEDLSKLSLDKKQVGHNKQPSIRSSE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TRPC6 Blocking Peptide, catalog no. 33R-4464, is also available for use as a blocking control in assays to test for specificity of this TRPC6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPC6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TRPC6

Antigène: TRPC6 (Transient Receptor Potential Cation Channel, Subfamily C, Member 6 (TRPC6))

Autre désignation: TRPC6 (TRPC6 Produits)

Synonymes: anticorps FSGS2, anticorps TRP6, anticorps AV025995, anticorps LLHWJM002, anticorps LLHWJM003, anticorps LLHWJM004, anticorps TRP-6, anticorps Trrp6, anticorps mtrp6, anticorps trp6, anticorps bZ1P14.9, anticorps si:rp71-1p14.9, anticorps trpc6, anticorps transient receptor potential cation channel subfamily C member 6, anticorps transient receptor potential cation channel, subfamily C, member 6, anticorps transient receptor potential cation channel, subfamily C, member 6a, anticorps TRPC6, anticorps Trpc6, anticorps trpc6a, anticorps trpc6

Sujet: TRPC6 forms a receptor-activated calcium channel in the cell membrane. The channel is activated by diacylglycerol and is thought to be under the control of a phosphatidylinositol second messenger system. Activation of this channel occurs independently of protein kinase C and is not triggered by low levels of intracellular calcium. Defects in this gene are a cause of focal segmental glomerulosclerosis 2 (FSGS2).

Poids moléculaire: 106 kDa (MW of target protein)