CACNA1I anticorps (Middle Region)
-
- Antigène Voir toutes CACNA1I Anticorps
- CACNA1I (Calcium Channel, Voltage Dependent, T Type, alpha 1I Subunit (CACNA1I))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CACNA1I est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CACNA1 I antibody was raised against the middle region of CACNA1
- Purification
- Affinity purified
- Immunogène
- CACNA1 I antibody was raised using the middle region of CACNA1 corresponding to a region with amino acids LRTDTGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSPWAS
- Top Product
- Discover our top product CACNA1I Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CACNA1I Blocking Peptide, catalog no. 33R-5397, is also available for use as a blocking control in assays to test for specificity of this CACNA1I antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CACNA0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CACNA1I (Calcium Channel, Voltage Dependent, T Type, alpha 1I Subunit (CACNA1I))
- Autre désignation
- CACNA1I (CACNA1I Produits)
- Synonymes
- anticorps CACNA1L, anticorps Ca(V)3.3, anticorps Cav3.3, anticorps ca(v)3.3, anticorps si:ch211-51h13.1, anticorps Ca(v)3.3, anticorps calcium voltage-gated channel subunit alpha1 I, anticorps voltage-dependent T-type calcium channel subunit alpha-1I, anticorps calcium channel, voltage-dependent, alpha 1I subunit, anticorps calcium channel, voltage-dependent, T type, alpha 1I subunit, anticorps CACNA1I, anticorps LOC100555412, anticorps Cacna1i, anticorps cacna1i
- Sujet
- Voltage-dependent calcium channels control the rapid entry of Ca(2+) into a variety of cell types and are therefore involved in both electrical and cellular signaling. T-type channels, such as CACNA1I, are activated by small membrane depolarizations and can generate burst firing and pacemaker activity.
- Poids moléculaire
- 245 kDa (MW of target protein)
-