KCNC3 anticorps (Middle Region)

N° du produit ABIN633709

Détail du produit anti-KCNC3 anticorps

Antigène: KCNC3 (Potassium Voltage-Gated Channel, Shaw-Related Subfamily, Member 3 (KCNC3))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KCNC3 est non-conjugé

Application: Western Blotting (WB)

Specificité: KCNC3 antibody was raised against the middle region of KCNC3

Purification: Affinity purified

Immunogène: KCNC3 antibody was raised using the middle region of KCNC3 corresponding to a region with amino acids YAERIGADPDDILGSNHTYFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KCNC3 Blocking Peptide, catalog no. 33R-10044, is also available for use as a blocking control in assays to test for specificity of this KCNC3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KCNC3

Antigène: KCNC3 (Potassium Voltage-Gated Channel, Shaw-Related Subfamily, Member 3 (KCNC3))

Autre désignation: KCNC3 (KCNC3 Produits)

Synonymes: anticorps kcnc3-A, anticorps Kv3.1, anticorps KShIIID, anticorps Kcr2-3, anticorps Kv3.3, anticorps KSHIIID, anticorps KV3.3, anticorps SCA13, anticorps kcnc1, anticorps kshiiid, anticorps kv3.3, anticorps sca13, anticorps potassium voltage-gated channel subfamily C member 3, anticorps potassium channel, voltage gated Shaw related subfamily C, member 1 S homeolog, anticorps potassium voltage gated channel, Shaw-related subfamily, member 3, anticorps potassium channel, voltage gated Shaw related subfamily C, member 3 L homeolog, anticorps potassium voltage-gated channel, Shaw-related subfamily, member 3, anticorps KCNC3, anticorps kcnc1.S, anticorps Kcnc3, anticorps kcnc3.L

Sujet: The Shaker gene family of Drosophila encodes components of voltage-gated potassium channels and is comprised of four subfamilies. Based on sequence similarity, this gene is similar to one of these subfamilies, namely the Shaw subfamily. KCNC3 belongs to the delayed rectifier class of channel proteins and is an integral membrane protein that mediates the voltage-dependent potassium ion permeability of excitable membranes.

Poids moléculaire: 80 kDa (MW of target protein)