Mucolipin 3 anticorps (Middle Region)

N° du produit ABIN633713

Détail du produit anti-Mucolipin 3 anticorps

Antigène: Mucolipin 3 (Mcoln3)

Épitope: Middle Region

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Mucolipin 3 est non-conjugé

Application: Western Blotting (WB)

Specificité: Mucolipin 3 antibody was raised against the middle region of MCOLN3

Purification: Affinity purified

Immunogène: Mucolipin 3 antibody was raised using the middle region of MCOLN3 corresponding to a region with amino acids TVELQFKLKAINLQTVRHQELPDCYDFTLTITFDNKAHSGRIKISLDNDI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Mucolipin 3 Blocking Peptide, catalog no. 33R-9348, is also available for use as a blocking control in assays to test for specificity of this Mucolipin 3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MCOLN3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Mucolipin 3

Antigène: Mucolipin 3 (Mcoln3)

Autre désignation: Mucolipin 3 (Mcoln3 Produits)

Synonymes: anticorps MCOLN3, anticorps 6720490O21Rik, anticorps TRPML3, anticorps Va, anticorps TRP-ML3, anticorps trp-ml3, anticorps trpml3, anticorps mucolipin 3, anticorps mucolipin 3 S homeolog, anticorps MCOLN3, anticorps mcoln3, anticorps Mcoln3, anticorps mcoln3.S

Sujet: Mucolipins constitute a family of cation channel proteins with homologs in mouse, Drosophila, and C. elegans. Mutations in the human MCOLN1 gene cause mucolipodosis IV.

Poids moléculaire: 64 kDa (MW of target protein)

Pathways: Sensory Perception of Sound