TRPM8 anticorps (N-Term)

N° du produit ABIN633722

Détail du produit anti-TRPM8 anticorps

Antigène: TRPM8 (Transient Receptor Potential Cation Channel, Subfamily M, Member 8 (TRPM8))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TRPM8 est non-conjugé

Application: Western Blotting (WB)

Specificité: TRPM8 antibody was raised against the N terminal of TRPM8

Purification: Affinity purified

Immunogène: TRPM8 antibody was raised using the N terminal of TRPM8 corresponding to a region with amino acids YILDNNHTHLLLVDNGCHGHPTVEAKLRNQLEKYISERTIQDSNYGGKIP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TRPM8 Blocking Peptide, catalog no. 33R-10139, is also available for use as a blocking control in assays to test for specificity of this TRPM8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPM8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TRPM8

Antigène: TRPM8 (Transient Receptor Potential Cation Channel, Subfamily M, Member 8 (TRPM8))

Autre désignation: TRPM8 (TRPM8 Produits)

Synonymes: anticorps TRPM8, anticorps trpp8, anticorps ltrpc6, anticorps trpm8b, anticorps LTRPC6, anticorps TRPP8, anticorps CMR1, anticorps LTrpC-6, anticorps Trp-p8, anticorps transient receptor potential cation channel subfamily M member 8, anticorps transient receptor potential cation channel subfamily M member 8b L homeolog, anticorps transient receptor potential cation channel, subfamily M, member 8, anticorps TRPM8, anticorps trpm8b.L, anticorps Trpm8

Sujet: TRPM8 is the receptor-activated non-selective cation channel involved in detection of sensations such as coolness, by being activated by cold temperature below 25 degrees Celsius. TRPM8 is activated by icilin, eucalyptol, menthol, cold and modulation of intracellular pH. TRPM8 is involved in menthol sensation. TRPM8 is permeable for monovalent cations sodium, potassium, and cesium and divalent cation calcium. Temperature sensing is tightly linked to voltage-dependent gating. TRPM8 was activated upon depolarization, changes in temperature resulting in graded shifts of its voltage-dependent activation curves. The chemical agonists menthol functions as a gating modifier, shifting activation curves towards physiological membrane potentials. Temperature sensitivity arises from a tenfold difference in the activation energies associated with voltage-dependent opening and closing.

Poids moléculaire: 128 kDa (MW of target protein)