TRPV4 anticorps (Middle Region)

N° du produit ABIN633737

Détail du produit anti-TRPV4 anticorps

Antigène: TRPV4 (Transient Receptor Potential Cation Channel, Subfamily V, Member 4 (TRPV4))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TRPV4 est non-conjugé

Application: Western Blotting (WB)

Specificité: TRPV4 antibody was raised against the middle region of TRPV4

Purification: Affinity purified

Immunogène: TRPV4 antibody was raised using the middle region of TRPV4 corresponding to a region with amino acids RVDEVNWSHWNQNLGIINEDPGKNETYQYYGFSHTVGRLRRDRWSSVVPR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TRPV4 Blocking Peptide, catalog no. 33R-8239, is also available for use as a blocking control in assays to test for specificity of this TRPV4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPV4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TRPV4

Antigène: TRPV4 (Transient Receptor Potential Cation Channel, Subfamily V, Member 4 (TRPV4))

Autre désignation: TRPV4 (TRPV4 Produits)

Synonymes: anticorps wu:fp52e02, anticorps CMT2C, anticorps HMSN2C, anticorps OTRPC4, anticorps SMAL, anticorps SPSMA, anticorps SSQTL1, anticorps TRP12, anticorps VRL2, anticorps VROAC, anticorps 0610033B08Rik, anticorps Trp12, anticorps VR-OAC, anticorps VRL-2, anticorps Otrpc4, anticorps Vroac, anticorps transient receptor potential cation channel, subfamily V, member 4, anticorps transient receptor potential cation channel subfamily V member 4, anticorps trpv4, anticorps TRPV4, anticorps Trpv4

Sujet: TRPV4 is a non-selective calcium permeant cation channel probably involved in osmotic sensitivity and mechanosensitivity. Activation of TRPV4 by exposure to hypotonicity within the physiological range exhibits an outward rectification. TRPV4 also activated by low pH, citrate and phorbol esters and increase of intracellular Ca2+ potentiates currents. Channel activity seems to be regulated by a calmodulin-dependent mechanism with a negative feedback mechanism.

Poids moléculaire: 91 kDa (MW of target protein)

Pathways: Hormone Transport, Cell-Cell Junction Organization