KCNH2 anticorps

N° du produit ABIN633738

Détail du produit anti-KCNH2 anticorps

Antigène: KCNH2 (Potassium Voltage-Gated Channel, Subfamily H (Eag-Related), Member 2 (KCNH2))

Reactivité: Humain, Rat, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KCNH2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: KCNH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KCNH2 Blocking Peptide, catalog no. 33R-8732, is also available for use as a blocking control in assays to test for specificity of this KCNH2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNH2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KCNH2

Antigène: KCNH2 (Potassium Voltage-Gated Channel, Subfamily H (Eag-Related), Member 2 (KCNH2))

Autre désignation: KCNH2 (KCNH2 Produits)

Synonymes: anticorps ERG1, anticorps HERG, anticorps HERG1, anticorps Kv11.1, anticorps LQT2, anticorps SQT1, anticorps erg, anticorps KCNH2, anticorps ERG, anticorps gp-erg, anticorps cerg, anticorps derg, anticorps erg1, anticorps AI326795, anticorps LQT, anticorps Lqt2, anticorps M-erg, anticorps Merg1, anticorps merg1a, anticorps merg1b, anticorps potassium voltage-gated channel subfamily H member 2, anticorps potassium voltage-gated channel, subfamily H (eag-related), member 6a, anticorps potassium voltage-gated channel, subfamily H (eag-related), member 2, anticorps potassium voltage-gated channel subfamily H member 6, anticorps KCNH2, anticorps kcnh6a, anticorps Kcnh2, anticorps KCNH6

Sujet: This gene encodes a voltage-activated potassium channel belonging to the eag family. It shares sequence similarity with the Drosophila ether-a-go-go (eag) gene. Mutations in this gene can cause long QT syndrome type 2 (LQT2).

Poids moléculaire: 90 kDa (MW of target protein)