P2RX2 anticorps (N-Term)

N° du produit ABIN633739

Détail du produit anti-P2RX2 anticorps

Antigène: P2RX2 (Purinergic Receptor P2X, Ligand Gated Ion Channel 2 (P2RX2))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp P2RX2 est non-conjugé

Application: Western Blotting (WB)

Specificité: P2 RX2 antibody was raised against the N terminal of P2 X2

Purification: Affinity purified

Immunogène: P2 RX2 antibody was raised using the N terminal of P2 X2 corresponding to a region with amino acids YFVWYVFIVQKSYQESETGPESSIITKVKGITTSEHKVWDVEEYVKPPEG

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

P2RX2 Blocking Peptide, catalog no. 33R-10100, is also available for use as a blocking control in assays to test for specificity of this P2RX2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of P0 X2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur P2RX2

Antigène: P2RX2 (Purinergic Receptor P2X, Ligand Gated Ion Channel 2 (P2RX2))

Autre désignation: P2RX2 (P2RX2 Produits)

Synonymes: anticorps DFNA41, anticorps P2X2, anticorps P2X2a, anticorps P2x2, anticorps p2xr2, anticorps P2RX2, anticorps purinergic receptor P2X 2, anticorps purinergic receptor P2X, ligand-gated ion channel, 2, anticorps P2RX2, anticorps P2rx2, anticorps p2rx2

Sujet: The product of P2RX2 belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Binding to ATP mediates synaptic transmission between neurons and from neurons to smooth muscle.

Poids moléculaire: 52 kDa (MW of target protein)

Pathways: Skeletal Muscle Fiber Development, Positive Regulation of Endopeptidase Activity