TRPV4 anticorps (Middle Region)

N° du produit ABIN633742

Détail du produit anti-TRPV4 anticorps

Antigène: TRPV4 (Transient Receptor Potential Cation Channel, Subfamily V, Member 4 (TRPV4))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TRPV4 est non-conjugé

Application: Western Blotting (WB)

Specificité: TRPV4 antibody was raised against the middle region of TRPV4

Purification: Affinity purified

Immunogène: TRPV4 antibody was raised using the middle region of TRPV4 corresponding to a region with amino acids RVDEVNWSHWNQNLGIINEDPGKNETYQYYGFSHTVGRLRRDRWSSVVPR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TRPV4 Blocking Peptide, catalog no. 33R-8240, is also available for use as a blocking control in assays to test for specificity of this TRPV4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPV4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TRPV4

Antigène: TRPV4 (Transient Receptor Potential Cation Channel, Subfamily V, Member 4 (TRPV4))

Autre désignation: TRPV4 (TRPV4 Produits)

Synonymes: anticorps wu:fp52e02, anticorps CMT2C, anticorps HMSN2C, anticorps OTRPC4, anticorps SMAL, anticorps SPSMA, anticorps SSQTL1, anticorps TRP12, anticorps VRL2, anticorps VROAC, anticorps 0610033B08Rik, anticorps Trp12, anticorps VR-OAC, anticorps VRL-2, anticorps Otrpc4, anticorps Vroac, anticorps transient receptor potential cation channel, subfamily V, member 4, anticorps transient receptor potential cation channel subfamily V member 4, anticorps trpv4, anticorps TRPV4, anticorps Trpv4

Sujet: TRPV4 is a member of the OSM9-like transient receptor potential channel (OTRPC) subfamily in the transient receptor potential (TRP) superfamily of ion channels. TRPV4 is a Ca2+-permeable, nonselective cation channel that is thought to be involved in the regulation of systemic osmotic pressure.

Poids moléculaire: 91 kDa (MW of target protein)

Pathways: Hormone Transport, Cell-Cell Junction Organization