KCNMB3 anticorps (Middle Region)
-
- Antigène Voir toutes KCNMB3 Anticorps
- KCNMB3 (Potassium Large Conductance Calcium-Activated Channel, Subfamily M beta Member 3 (KCNMB3))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp KCNMB3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- KCNMB3 antibody was raised against the middle region of KCNMB3
- Purification
- Affinity purified
- Immunogène
- KCNMB3 antibody was raised using the middle region of KCNMB3 corresponding to a region with amino acids SLTLLGGALIVGMVRLTQHLSLLCEKYSTVVRDEVGGKVPYIEQHQFKLC
- Top Product
- Discover our top product KCNMB3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
KCNMB3 Blocking Peptide, catalog no. 33R-8629, is also available for use as a blocking control in assays to test for specificity of this KCNMB3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNMB3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- KCNMB3 (Potassium Large Conductance Calcium-Activated Channel, Subfamily M beta Member 3 (KCNMB3))
- Autre désignation
- KCNMB3 (KCNMB3 Produits)
- Synonymes
- anticorps KCNMB3, anticorps BKBETA3, anticorps HBETA3, anticorps KCNMB2, anticorps KCNMBL, anticorps SLOBETA3, anticorps EG435726, anticorps Gm5707, anticorps potassium calcium-activated channel subfamily M regulatory beta subunit 3, anticorps potassium channel subfamily M regulatory beta subunit 3 S homeolog, anticorps potassium large conductance calcium-activated channel, subfamily M beta member 3, anticorps potassium large conductance calcium-activated channel, subfamily M, beta member 3, anticorps KCNMB3, anticorps kcnmb3.S, anticorps Kcnmb3
- Sujet
- KCNMB3 is an auxiliary beta subunit which may partially inactivate or slightly decrease the activation time of MaxiK alpha subunit currents. At least four transcript variants encoding four different isoforms have been found for KCNMB3.MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit and the modulatory beta subunit.
- Poids moléculaire
- 31 kDa (MW of target protein)
-