P2RX4 anticorps (N-Term)

N° du produit ABIN633745

Détail du produit anti-P2RX4 anticorps

Antigène: P2RX4 (Purinergic Receptor P2X, Ligand-Gated Ion Channel, 4 (P2RX4))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp P2RX4 est non-conjugé

Application: Western Blotting (WB)

Specificité: P2 RX4 antibody was raised against the N terminal of P2 X4

Purification: Affinity purified

Immunogène: P2 RX4 antibody was raised using the N terminal of P2 X4 corresponding to a region with amino acids VQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKVKGVAVTNTSKLGFRIW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

P2RX4 Blocking Peptide, catalog no. 33R-9751, is also available for use as a blocking control in assays to test for specificity of this P2RX4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of P0 X4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur P2RX4

Antigène: P2RX4 (Purinergic Receptor P2X, Ligand-Gated Ion Channel, 4 (P2RX4))

Autre désignation: P2RX4 (P2RX4 Produits)

Synonymes: anticorps P2X4, anticorps P2X4R, anticorps AI504491, anticorps AW555605, anticorps D5Ertd444e, anticorps p2rx4, anticorps p2x4, anticorps wu:fi03f02, anticorps p2x4r, anticorps p2rx4.2, anticorps p2xr4.2, anticorps purinergic receptor P2X 4, anticorps purinergic receptor P2X, ligand-gated ion channel 4, anticorps purinergic receptor P2X, ligand-gated ion channel, 4a, anticorps purinergic receptor P2X, ligand gated ion channel, 4 L homeolog, anticorps purinergic receptor P2X, ligand-gated ion channel, 4b, anticorps P2RX4, anticorps P2rx4, anticorps p2rx4a, anticorps p2rx4.L, anticorps p2rx4b

Sujet: The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel with high calcium permeability. The main pharmacological distinction between the members of the purinoceptor family is the relative sensitivity to the antagonists suramin and PPADS.

Poids moléculaire: 43 kDa (MW of target protein)

Pathways: Synaptic Membrane