KCNH3 anticorps
-
- Antigène Voir toutes KCNH3 (Kcnh3) Anticorps
- KCNH3 (Kcnh3) (Potassium Voltage-Gated Channel, Subfamily H (Eag-Related), Member 3 (Kcnh3))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp KCNH3 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- KCNH3 antibody was raised using a synthetic peptide corresponding to a region with amino acids LYPEFAPRFSRGLRGELSYNLGAGGGSAEVDTSSLSGDNTLMSTLEEKET
- Top Product
- Discover our top product Kcnh3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
KCNH3 Blocking Peptide, catalog no. 33R-5570, is also available for use as a blocking control in assays to test for specificity of this KCNH3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNH3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- KCNH3 (Kcnh3) (Potassium Voltage-Gated Channel, Subfamily H (Eag-Related), Member 3 (Kcnh3))
- Autre désignation
- KCNH3 (Kcnh3 Produits)
- Synonymes
- anticorps BEC1, anticorps ELK2, anticorps Kv12.2, anticorps AU019351, anticorps C030044P22Rik, anticorps Elk2, anticorps Melk2, anticorps Bec1, anticorps potassium voltage-gated channel subfamily H member 3, anticorps potassium voltage-gated channel, subfamily H (eag-related), member 3, anticorps KCNH3, anticorps Kcnh3
- Sujet
- This gene encodes a pore-forming (alpha) subunit of voltage-gated potassium channel. Elicits an outward current with fast inactivation. Channel properties may be modulated by cAMP and subunit assembly
- Poids moléculaire
- 117 kDa (MW of target protein)
-