TRPV5 anticorps (N-Term)

N° du produit ABIN633749

Détail du produit anti-TRPV5 anticorps

Antigène: TRPV5 (Transient Receptor Potential Cation Channel, Subfamily V, Member 5 (TRPV5))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TRPV5 est non-conjugé

Application: Western Blotting (WB)

Specificité: TRPV5 antibody was raised against the N terminal of TRPV5

Purification: Affinity purified

Immunogène: TRPV5 antibody was raised using the N terminal of TRPV5 corresponding to a region with amino acids MLQQKRILESPLLRASKENDLSVLRQLLLDCTCDVRQRGALGETALHIAA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TRPV5 Blocking Peptide, catalog no. 33R-6206, is also available for use as a blocking control in assays to test for specificity of this TRPV5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPV5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TRPV5

Antigène: TRPV5 (Transient Receptor Potential Cation Channel, Subfamily V, Member 5 (TRPV5))

Autre désignation: TRPV5 (TRPV5 Produits)

Synonymes: anticorps CaT2, anticorps Ecac1, anticorps CAT2, anticorps ECAC1, anticorps OTRPC3, anticorps D630033B11, anticorps TRPV5, anticorps ECAC, anticorps cat2, anticorps xcat2, anticorps transient receptor potential cation channel, subfamily V, member 5, anticorps transient receptor potential cation channel subfamily V member 5, anticorps calcium transporter 2 L homeolog, anticorps Trpv5, anticorps TRPV5, anticorps LOC100011049, anticorps trpv5, anticorps cat2.L

Sujet: TRPV5 is a member of the transient receptor family and the TrpV subfamily. TRPV5, a calcium-selective channel, has 6 transmembrane-spanning domains, multiple potential phosphorylation sites, an N-linked glycosylation site, and 5 ANK repeats. TRPV5 forms homotetramers or heterotetramers and is activated by a low internal calcium level.

Poids moléculaire: 82 kDa (MW of target protein)