KCNG4 anticorps (N-Term)

N° du produit ABIN633751

Détail du produit anti-KCNG4 anticorps

Antigène: KCNG4 (Kcng4) (Potassium Voltage-Gated Channel, Subfamily G, Member 4 (Kcng4))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KCNG4 est non-conjugé

Application: Western Blotting (WB)

Specificité: KCNG4 antibody was raised against the N terminal of KCNG4

Purification: Affinity purified

Immunogène: KCNG4 antibody was raised using the N terminal of KCNG4 corresponding to a region with amino acids QEELAYWGIEEAHLERCCLRKLLRKLEELEELAKLHREDVLRQQRETRRP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KCNG4 Blocking Peptide, catalog no. 33R-7518, is also available for use as a blocking control in assays to test for specificity of this KCNG4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNG4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KCNG4

Antigène: KCNG4 (Kcng4) (Potassium Voltage-Gated Channel, Subfamily G, Member 4 (Kcng4))

Autre désignation: KCNG4 (Kcng4 Produits)

Synonymes: anticorps si:dkey-246g23.3, anticorps KV6.3, anticorps KV6.4, anticorps 4921535I01Rik, anticorps AW049024, anticorps potassium voltage-gated channel, subfamily G, member 4a, anticorps potassium voltage-gated channel modifier subfamily G member 4, anticorps potassium voltage-gated channel, subfamily G, member 4, anticorps kcng4a, anticorps KCNG4, anticorps Kcng4

Sujet: Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. KCNG4 is a member of the potassium channel, voltage-gated, subfamily G. This member functions as a modulatory subunit. The protein has strong expression in brain.

Poids moléculaire: 59 kDa (MW of target protein)