GRIK5 anticorps (Middle Region)

N° du produit ABIN633785

Détail du produit anti-GRIK5 anticorps

Antigène: GRIK5 (Glutamate Receptor, Ionotropic, Kainate 5 (GRIK5))

Épitope: Middle Region

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GRIK5 est non-conjugé

Application: Western Blotting (WB)

Specificité: GRIK5 antibody was raised against the middle region of GRIK5

Purification: Affinity purified

Immunogène: GRIK5 antibody was raised using the middle region of GRIK5 corresponding to a region with amino acids EDGLYGAPEPNGSWTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GRIK5 Blocking Peptide, catalog no. 33R-2313, is also available for use as a blocking control in assays to test for specificity of this GRIK5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GRIK5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GRIK5

Antigène: GRIK5 (Glutamate Receptor, Ionotropic, Kainate 5 (GRIK5))

Autre désignation: GRIK5 (GRIK5 Produits)

Sujet: GRIK5 is a protein that belongs to the glutamate-gated ionic channel family. Glutamate functions as the major excitatory neurotransmitter in the central nervous system through activation of ligand-gated ion channels and G protein-coupled membrane receptors. GRIK5 forms functional heteromeric kainate-preferring ionic channels with the subunits encoded by related gene family members.

Poids moléculaire: 108 kDa (MW of target protein)

Pathways: Carbohydrate Homeostasis, Synaptic Membrane, Maintenance of Protein Location, Synaptic Vesicle Exocytosis