DPYSL2 anticorps (Middle Region)

N° du produit ABIN633807

Détail du produit anti-DPYSL2 anticorps

Antigène: DPYSL2 (Dihydropyrimidinase-Like 2 (DPYSL2))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DPYSL2 est non-conjugé

Application: Western Blotting (WB)

Specificité: DPYSL2 antibody was raised against the middle region of DPYSL2

Purification: Affinity purified

Immunogène: DPYSL2 antibody was raised using the middle region of DPYSL2 corresponding to a region with amino acids NIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYKR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DPYSL2 Blocking Peptide, catalog no. 33R-6719, is also available for use as a blocking control in assays to test for specificity of this DPYSL2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPYSL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DPYSL2

Antigène: DPYSL2 (Dihydropyrimidinase-Like 2 (DPYSL2))

Autre désignation: DPYSL2 (DPYSL2 Produits)

Synonymes: anticorps CRMP-2, anticorps CRMP2, anticorps DHPRP2, anticorps DRP-2, anticorps DRP2, anticorps N2A3, anticorps ULIP-2, anticorps ULIP2, anticorps TOAD-64, anticorps crmp2, anticorps dhprp2, anticorps drp-2, anticorps drp2, anticorps unc-33, anticorps unc33, anticorps dpysl2, anticorps CRMP 2, anticorps PCRMP 2, anticorps PCRMP-2, anticorps PCRMP2, anticorps PfCRMP 2, anticorps PfCRMP-2, anticorps AI851130, anticorps Crmp2, anticorps Musunc33, anticorps Ulip2, anticorps CRMP2A, anticorps dihydropyrimidinase like 2, anticorps dihydropyrimidinase-like 2, anticorps dihydropyrimidinase like 2 L homeolog, anticorps dihydropyrimidinase-like 2b, anticorps cysteine repeat modular protein 2, putative, anticorps DPYSL2, anticorps dpysl2.L, anticorps dpysl2b, anticorps PfCRMP2, anticorps dpysl2, anticorps Dpysl2

Sujet: DPYSL2 belongs to the DHOase family. It is necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. The protein plays a role in axon guidance, neuronal growth cone collapse and cell migration.

Poids moléculaire: 62 kDa (MW of target protein)

Pathways: Regulation of Cell Size