CRMP1 anticorps (N-Term)
-
- Antigène Voir toutes CRMP1 Anticorps
- CRMP1 (Collapsin Response Mediator Protein 1 (CRMP1))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CRMP1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CRMP1 antibody was raised against the N terminal of CRMP1
- Purification
- Affinity purified
- Immunogène
- CRMP1 antibody was raised using the N terminal of CRMP1 corresponding to a region with amino acids MSYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLI
- Top Product
- Discover our top product CRMP1 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CRMP1 Blocking Peptide, catalog no. 33R-6529, is also available for use as a blocking control in assays to test for specificity of this CRMP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRMP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CRMP1 (Collapsin Response Mediator Protein 1 (CRMP1))
- Autre désignation
- CRMP1 (CRMP1 Produits)
- Synonymes
- anticorps CRMP1, anticorps crmp1, anticorps MGC145930, anticorps CRMP 1, anticorps CRMP-1, anticorps PCRMP 1, anticorps PCRMP-1, anticorps PCRMP1, anticorps PfCRMP-1, anticorps DPYSL1, anticorps DRP-1, anticorps DRP1, anticorps ULIP-3, anticorps Dpysl1, anticorps Ulip3, anticorps CRMP1B, anticorps collapsin response mediator protein 1, anticorps dihydropyrimidinase-related protein 1, anticorps cysteine repeat modular protein 1, putative, anticorps collapsin response mediator protein 1 L homeolog, anticorps CRMP1, anticorps crmp1, anticorps LOC100350067, anticorps PfCRMP1, anticorps Crmp1, anticorps crmp1.L
- Sujet
- CRMP1 is a member of a family of cytosolic phosphoproteins expressed exclusively in the nervous system. The protein is thought to be a part of the semaphorin signal transduction pathway implicated in semaphorin-induced growth cone collapse during neural development.
- Poids moléculaire
- 63 kDa (MW of target protein)
-