MST1 anticorps

N° du produit ABIN633854

Détail du produit anti-MST1 anticorps

Antigène: MST1 (Macrophage Stimulating 1 (Hepatocyte Growth Factor-Like) (MST1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MST1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: MST1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SCHMPLTGYEVWLGTLFQNPQHGEPSLQRVPVAKMVCGPSGSQLVLLKLE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MST1 Blocking Peptide, catalog no. 33R-8329, is also available for use as a blocking control in assays to test for specificity of this MST1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MST1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MST1

Antigène: MST1 (Macrophage Stimulating 1 (Hepatocyte Growth Factor-Like) (MST1))

Autre désignation: MST1 (MST1 Produits)

Synonymes: anticorps D3F15S2, anticorps DNF15S2, anticorps HGFL, anticorps MSP, anticorps NF15S2, anticorps E2F2, anticorps D3F15S2h, anticorps D9H3F15S2, anticorps DNF15S2h, anticorps Hgfl, anticorps HGF1/MSP, anticorps E1A, anticorps XHL, anticorps d3f15s2, anticorps dnf15s2, anticorps hgfl, anticorps msp, anticorps mst1, anticorps nf15s2, anticorps macrophage stimulating 1, anticorps macrophage stimulating 1 (hepatocyte growth factor-like), anticorps serine/threonine kinase 4, anticorps macrophage stimulating 1 L homeolog, anticorps MST1, anticorps Mst1, anticorps STK4, anticorps mst1.L

Sujet: MST1 belongs to the peptidase S1 family, plasminogen subfamily. It contains 4 kringle domains, 1 PAN domain and 1 peptidase S1 domain. MST1 probably has no proteolytic activity, since crucial characteristic of serine proteases catalytic sites are not conserved.

Poids moléculaire: 80 kDa (MW of target protein)