WNT3A anticorps (N-Term)

N° du produit ABIN633857

Détail du produit anti-WNT3A anticorps

Antigène: WNT3A (Wingless-Type MMTV Integration Site Family, Member 3A (WNT3A))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp WNT3A est non-conjugé

Application: Western Blotting (WB)

Specificité: WNT3 A antibody was raised against the N terminal of WNT3

Purification: Affinity purified

Immunogène: WNT3 A antibody was raised using the N terminal of WNT3 corresponding to a region with amino acids MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

WNT3A Blocking Peptide, catalog no. 33R-5711, is also available for use as a blocking control in assays to test for specificity of this WNT3A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WNT0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur WNT3A

Antigène: WNT3A (Wingless-Type MMTV Integration Site Family, Member 3A (WNT3A))

Autre désignation: WNT3A (WNT3A Produits)

Synonymes: anticorps WNT3A, anticorps Wnt-3a, anticorps vt, anticorps Zwnt[a], anticorps wnt3, anticorps wnt3 l, anticorps wnt3l, anticorps wnt[a], anticorps Xwnt-3a, anticorps wnt-3a, anticorps wnt3a-A, anticorps xwnt3a, anticorps WNT-3A, anticorps WNT3, anticorps wingless-type MMTV integration site family, member 3A, anticorps Wnt family member 3A, anticorps wingless-type MMTV integration site family member 3A L homeolog, anticorps WNT3A, anticorps Wnt3a, anticorps wnt3a, anticorps wnt3a.L

Sujet: The WNT gene family consists of structurally related genes which encode secreted signaling proteins.

Poids moléculaire: 39 kDa (MW of target protein)

Pathways: Signalisation WNT, Regulation of Muscle Cell Differentiation, Regulation of Cell Size, Positive Regulation of Endopeptidase Activity