CYP1B1 anticorps (Middle Region)

N° du produit ABIN633889

Détail du produit anti-CYP1B1 anticorps

Antigène: CYP1B1 (Cytochrome P450, Family 1, Subfamily B, Polypeptide 1 (CYP1B1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CYP1B1 est non-conjugé

Application: Western Blotting (WB)

Specificité: CYP1 B1 antibody was raised against the middle region of CYP1 1

Purification: Affinity purified

Immunogène: CYP1 B1 antibody was raised using the middle region of CYP1 1 corresponding to a region with amino acids AVANVMSAVCFGCRYSHDDPEFRELLSHNEEFGRTVGAGSLVDVMPWLQY

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CYP1B1 Blocking Peptide, catalog no. 33R-1584, is also available for use as a blocking control in assays to test for specificity of this CYP1B1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CYP1B1

Antigène: CYP1B1 (Cytochrome P450, Family 1, Subfamily B, Polypeptide 1 (CYP1B1))

Autre désignation: CYP1B1 (CYP1B1 Produits)

Synonymes: anticorps CP1B, anticorps CYPIB1, anticorps GLC3A, anticorps P4501B1, anticorps P4501b1, anticorps CYP1B1, anticorps CYP1B, anticorps zgc:136223, anticorps cytochrome P450 family 1 subfamily B member 1, anticorps cytochrome P450, family 1, subfamily b, polypeptide 1, anticorps cytochrome P450, family 1, subfamily B, polypeptide 1, anticorps cytochrome P450 1B1, anticorps CYP1B1, anticorps Cyp1b1, anticorps cyp1b1, anticorps LOC100719054

Sujet: CYP1B1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. CYP1B1 localizes to the endoplasmic reticulum and metabolizes procarcinogens such as polycyclic aromatic hydrocarbons and 17beta-estradiol. Mutations in this gene have been associated with primary congenital glaucoma, therefore it is thought that the enzyme also metabolizes a signaling molecule involved in eye development, possibly a steroid.

Poids moléculaire: 61 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis