CYP2C9 anticorps (C-Term)

N° du produit ABIN633894

Détail du produit anti-CYP2C9 anticorps

Antigène: CYP2C9 (Cytochrome P450, Family 2, Subfamily C, Polypeptide 9 (CYP2C9))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CYP2C9 est non-conjugé

Application: Western Blotting (WB)

Specificité: CYP2 C9 antibody was raised against the C terminal of CYP2 9

Purification: Affinity purified

Immunogène: CYP2 C9 antibody was raised using the C terminal of CYP2 9 corresponding to a region with amino acids AGMELFLFLTSILQNFNLKSLVDPKNLDTTPVVNGFASVPPFYQLCFIPV

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CYP2C9 Blocking Peptide, catalog no. 33R-1211, is also available for use as a blocking control in assays to test for specificity of this CYP2C9 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CYP2C9

Antigène: CYP2C9 (Cytochrome P450, Family 2, Subfamily C, Polypeptide 9 (CYP2C9))

Autre désignation: CYP2C9 (CYP2C9 Produits)

Synonymes: anticorps CPC9, anticorps CYP2C, anticorps CYP2C10, anticorps CYPIIC9, anticorps P450IIC9, anticorps cytochrome P450 family 2 subfamily C member 9, anticorps CYP2C9

Sujet: CYP2C9 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by rifampin. The enzyme is known to metabolize many xenobiotics, including phenytoin, tolbutamide, ibuprofen and S-warfarin. Studies identifying individuals who are poor metabolizers of phenytoin and tolbutamide suggest that CYP2C9 gene is polymorphic.

Poids moléculaire: 55 kDa (MW of target protein)