NDUFS3 anticorps (Middle Region)

N° du produit ABIN633898

Détail du produit anti-NDUFS3 anticorps

Antigène: NDUFS3 (NADH Dehydrogenase (Ubiquinone) Fe-S Protein 3, 30kDa (NADH-Coenzyme Q Reductase) (NDUFS3))

Épitope: Middle Region

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NDUFS3 est non-conjugé

Application: Western Blotting (WB)

Specificité: NDUFS3 antibody was raised against the middle region of NDUFS3

Purification: Affinity purified

Immunogène: NDUFS3 antibody was raised using the middle region of NDUFS3 corresponding to a region with amino acids EVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLEAGDKKPDAK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NDUFS3 Blocking Peptide, catalog no. 33R-2797, is also available for use as a blocking control in assays to test for specificity of this NDUFS3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDUFS3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NDUFS3

Antigène: NDUFS3 (NADH Dehydrogenase (Ubiquinone) Fe-S Protein 3, 30kDa (NADH-Coenzyme Q Reductase) (NDUFS3))

Autre désignation: NDUFS3 (NDUFS3 Produits)

Synonymes: anticorps CI-30, anticorps 0610010M09Rik, anticorps CI-30kD, anticorps GB15355, anticorps zgc:112520, anticorps NADH:ubiquinone oxidoreductase core subunit S3, anticorps NADH dehydrogenase (ubiquinone) Fe-S protein 3, anticorps NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial, anticorps NADH:ubiquinone oxidoreductase core subunit S3 S homeolog, anticorps NADH dehydrogenase (ubiquinone) Fe-S protein 3, (NADH-coenzyme Q reductase), anticorps NADH dehydrogenase (ubiquinone) Fe-S protein 3, 30kDa (NADH-coenzyme Q reductase), anticorps NDUFS3, anticorps Ndufs3, anticorps ndufs3, anticorps LOC411411, anticorps ndufs3.S, anticorps LOC100228726

Sujet: This gene encodes one of the iron-sulfur protein (IP) components of mitochondrial NADH:ubiquinone oxidoreductase (complex I). Mutations in this gene are associated with Leigh syndrome resulting from mitochondrial complex I deficiency.

Poids moléculaire: 30 kDa (MW of target protein)

Pathways: Negative Regulation of intrinsic apoptotic Signaling