PRELP anticorps (Middle Region)

N° du produit ABIN633916

Détail du produit anti-PRELP anticorps

Antigène: PRELP (Proline Arginine Rich End Leucine Rich Repeat Protein (PRELP))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PRELP est non-conjugé

Application: Western Blotting (WB)

Specificité: PRELP antibody was raised against the middle region of PRELP

Purification: Affinity purified

Immunogène: PRELP antibody was raised using the middle region of PRELP corresponding to a region with amino acids SNKIETIPNGYFKSFPNLAFIRLNYNKLTDRGLPKNSFNISNLLVLHLSH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PRELP Blocking Peptide, catalog no. 33R-8653, is also available for use as a blocking control in assays to test for specificity of this PRELP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRELP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PRELP

Antigène: PRELP (Proline Arginine Rich End Leucine Rich Repeat Protein (PRELP))

Autre désignation: PRELP (PRELP Produits)

Sujet: PRELP is a leucine-rich repeat protein present in connective tissue extracellular matrix. This protein functions as a molecule anchoring basement membranes to the underlying connective tissue. This protein has been shown to bind type I collagen to basement membranes and type II collagen to cartilage. It also binds the basement membrane heparan sulfate proteoglycan perlecan. This protein is suggested to be involved in the pathogenesis of Hutchinson-Gilford progeria (HGP), which is reported to lack the binding of collagen in basement membranes and cartilage.

Poids moléculaire: 42 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process