PNPLA4 anticorps (C-Term)

N° du produit ABIN633942

Détail du produit anti-PNPLA4 anticorps

Antigène: PNPLA4 (Patatin-Like phospholipase Domain Containing 4 (PNPLA4))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PNPLA4 est non-conjugé

Application: Western Blotting (WB)

Specificité: PNPLA4 antibody was raised against the C terminal of PNPLA4

Purification: Affinity purified

Immunogène: PNPLA4 antibody was raised using the C terminal of PNPLA4 corresponding to a region with amino acids SPFSGRLDISPQDKGQLDLYVNIAKQDIMLSLANLVRLNQALFPPSKRKM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PNPLA4 Blocking Peptide, catalog no. 33R-8673, is also available for use as a blocking control in assays to test for specificity of this PNPLA4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNPLA4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PNPLA4

Antigène: PNPLA4 (Patatin-Like phospholipase Domain Containing 4 (PNPLA4))

Autre désignation: PNPLA4 (PNPLA4 Produits)

Synonymes: anticorps PNPLA4, anticorps DXS1283E, anticorps GS2, anticorps iPLA2eta, anticorps patatin like phospholipase domain containing 4 L homeolog, anticorps patatin like phospholipase domain containing 4, anticorps pnpla4.L, anticorps PNPLA4

Sujet: PNPLA4 is a keratinocyte retinyl ester hydrolase. The protein also catalyzes fatty acyl CoA-dependent and independent retinol esterification, using triolein as substrate and generates diacylglyceride and free fatty acid.

Poids moléculaire: 28 kDa (MW of target protein)