CHST6 anticorps
-
- Antigène Voir toutes CHST6 Anticorps
- CHST6 (Carbohydrate (N-Acetylglucosamine 6-O) Sulfotransferase 6 (CHST6))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CHST6 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- CHST6 antibody was raised using a synthetic peptide corresponding to a region with amino acids QELCAGALQLLGYRPVYSEDEQRNLALDLVLPRGLNGFTWASSTASHPRN
- Top Product
- Discover our top product CHST6 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CHST6 Blocking Peptide, catalog no. 33R-7529, is also available for use as a blocking control in assays to test for specificity of this CHST6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHST6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CHST6 (Carbohydrate (N-Acetylglucosamine 6-O) Sulfotransferase 6 (CHST6))
- Autre désignation
- CHST6 (CHST6 Produits)
- Synonymes
- anticorps mcdc1, anticorps MCDC1, anticorps carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 6 L homeolog, anticorps carbohydrate sulfotransferase 6, anticorps carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 6, anticorps chst6.L, anticorps LOC711570, anticorps CHST6, anticorps LOC100477677, anticorps LOC489707
- Sujet
- CHST6 catalyzes the transfer of sulfate to position 6 of non-reducing N-acetylglucosamine (GlcNAc) residues of keratan. It mediates sulfation of keratan in cornea. Keratan sulfate plays a central role in maintaining corneal transparency. CHST6 acts on the non-reducing terminal GlcNAc of short and long carbohydrate substrates that have poly-N-acetyllactosamine structures.
- Poids moléculaire
- 44 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-