Tel:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@anticorps-enligne.fr

PLG anticorps (Plasminogen) (Middle Region) Primary Antibody

PLG Reactivité: Humain WB Hôte: Lapin Polyclonal unconjugated
Pubmed (2)
N° du produit ABIN633957
$647.32
Plus shipping costs $45.00
50 μg
local_shipping Destination: Etats-Unis
Envoi sous 9 à 11 jours ouvrables
  • Antigène
    PLG
    Épitope
    Middle Region
    Reactivité
    Humain
    Hôte
    Lapin
    Clonalité
    Polyclonal
    Conjugué
    Cet anticorp PLG est non-conjugé
    Application
    Western Blotting (WB)
    Specificité
    Plasminogen antibody was raised against the middle region of PLG
    Purification
    Affinity purified
    Immunogène
    Plasminogen antibody was raised using the middle region of PLG corresponding to a region with amino acids LISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLE
  • Indications d'application
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Commentaires

    Plasminogen Blocking Peptide, catalog no. 33R-5066, is also available for use as a blocking control in assays to test for specificity of this Plasminogen antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLG antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Conseil sur la manipulation
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Stock
    4 °C
    Stockage commentaire
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Giraud, Chabaud, Lejeune, Barbaria, Mallet: "The plasminogen-like molecule apically secreted by epithelial thyroid cells is sulfated." dans: Biochemical and biophysical research communications, Vol. 346, Issue 3, pp. 746-50, 2006 (PubMed).

    Giraud, Dicristofaro, De Micco, Lejeune, Barbaria, Mallet: "A plasminogen-like protein, present in the apical extracellular environment of thyroid epithelial cells, degrades thyroglobulin in vitro." dans: Biochemical and biophysical research communications, Vol. 338, Issue 2, pp. 1000-4, 2005 (PubMed).

  • Antigène
    PLG
    Autre désignation
    Plasminogen (PLG Antibody Extrait)
    Synonymes
    wu:fb70e09, PLG, LPA, plg, Ab1-346, AI649309, Pg, plasminogen, plg, PLG, Plg
    Sujet
    The protein encoded by this gene is a secreted blood zymogen that is activated by proteolysis and converted to plasmin and angiostatin.
    Poids moléculaire
    88 kDa (MW of target protein)
    Pathways
    Système du Complément, Lipid Metabolism
Vous êtes ici: