CYP2C18 anticorps (N-Term)

N° du produit ABIN633982

Détail du produit anti-CYP2C18 anticorps

Antigène: CYP2C18 (Cytochrome P450, Family 2, Subfamily C, Polypeptide 18 (CYP2C18))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CYP2C18 est non-conjugé

Application: Western Blotting (WB)

Specificité: CYP2 C18 antibody was raised against the N terminal of CYP2 18

Purification: Affinity purified

Immunogène: CYP2 C18 antibody was raised using the N terminal of CYP2 18 corresponding to a region with amino acids MDPAVALVLCLSCLFLLSLWRQSSGRGRLPSGPTPLPIIGNILQLDVKDM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CYP2C18 Blocking Peptide, catalog no. 33R-5855, is also available for use as a blocking control in assays to test for specificity of this CYP2C18 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 18 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CYP2C18

Antigène: CYP2C18 (Cytochrome P450, Family 2, Subfamily C, Polypeptide 18 (CYP2C18))

Autre désignation: CYP2C18 (CYP2C18 Produits)

Synonymes: anticorps CPCJ, anticorps CYP2C, anticorps P450C2C, anticorps P450IIC19, anticorps CPCI, anticorps CYP2C17, anticorps P450-6B/29C, anticorps P450IIC17, anticorps cpci, anticorps cyp2c, anticorps cyp2c17, anticorps p450-6b/29c, anticorps p450iic17, anticorps CYP2C18, anticorps MGC139147, anticorps cytochrome P450 family 2 subfamily C member 19, anticorps cytochrome P450 family 2 subfamily C member 18, anticorps cytochrome P450 family 2 subfamily C member 18 L homeolog, anticorps cytochrome P450, family 2, subfamily C, polypeptide 18, anticorps CYP2C19, anticorps CYP2C18, anticorps cyp2c18.L, anticorps cyp2c18

Sujet: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids.

Poids moléculaire: 56 kDa (MW of target protein)