PCSK1 anticorps (Middle Region)

N° du produit ABIN633993

Détail du produit anti-PCSK1 anticorps

Antigène: PCSK1 (Proprotein Convertase Subtilisin/kexin Type 1 (PCSK1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PCSK1 est non-conjugé

Application: Western Blotting (WB)

Specificité: PCSK1 antibody was raised against the middle region of PCSK1

Purification: Affinity purified

Immunogène: PCSK1 antibody was raised using the middle region of PCSK1 corresponding to a region with amino acids QSPKKSPSAKLNIPYENFYEALEKLNKPSQLKDSEDSLYNDYVDVFYNTK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PCSK1 Blocking Peptide, catalog no. 33R-7733, is also available for use as a blocking control in assays to test for specificity of this PCSK1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCSK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PCSK1

Antigène: PCSK1 (Proprotein Convertase Subtilisin/kexin Type 1 (PCSK1))

Autre désignation: PCSK1 (PCSK1 Produits)

Sujet: PCSK1 is involved in the processing of hormone and other protein precursors at sites comprised of pairs of basic amino acid residues. Substrates include POMC, renin, enkephalin, dynorphin, somatostatin and insulin.

Poids moléculaire: 71 kDa (MW of target protein)

Pathways: Peptide Hormone Metabolism