CPN1 anticorps (Middle Region)
-
- Antigène Voir toutes CPN1 Anticorps
- CPN1 (Carboxypeptidase N Subunit 1 (CPN1))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CPN1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Carboxypeptidase N1 antibody was raised against the middle region of CPN1
- Purification
- Affinity purified
- Immunogène
- Carboxypeptidase N1 antibody was raised using the middle region of CPN1 corresponding to a region with amino acids EWLGNREALIQFLEQVHQGIKGMVLDENYNNLANAVISVSGINHDVTSGD
- Top Product
- Discover our top product CPN1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Carboxypeptidase N1 Blocking Peptide, catalog no. 33R-2812, is also available for use as a blocking control in assays to test for specificity of this Carboxypeptidase N1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPN1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CPN1 (Carboxypeptidase N Subunit 1 (CPN1))
- Autre désignation
- Carboxypeptidase N1 (CPN1 Produits)
- Synonymes
- anticorps CPN, anticorps SCPN, anticorps Cpn, anticorps cb1037, anticorps fa99g08, anticorps wu:fa99g08, anticorps zgc:77485, anticorps cpn, anticorps scpn, anticorps 0610011F20Rik, anticorps carboxypeptidase N subunit 1, anticorps carboxypeptidase N, polypeptide 1, anticorps carboxypeptidase N subunit 1 S homeolog, anticorps CPN1, anticorps Cpn1, anticorps cpn1, anticorps cpn1.S
- Sujet
- Carboxypeptidase N is a plasma metallo-protease that cleaves basic amino acids from the C terminal of peptides and proteins. The enzyme is important in the regulation of peptides like kinins and anaphylatoxins, and has also been known as kininase-1 and anaphylatoxin inactivator. This enzyme is a tetramer comprised of two identical regulatory subunits and two identical catalytic subunits, this gene encodes the catalytic subunit. Mutations in this gene can be associated with angioedema or chronic urticaria resulting from carboxypeptidase N deficiency.
- Poids moléculaire
- 50 kDa (MW of target protein)
- Pathways
- Metabolism of Steroid Hormones and Vitamin D, Steroid Hormone Biosynthesis, Peptide Hormone Metabolism, Regulation of Systemic Arterial Blood Pressure by Hormones, C21-Steroid Hormone Metabolic Process
-