SERPINA5 anticorps (C-Term)

N° du produit ABIN634035

Détail du produit anti-SERPINA5 anticorps

Antigène: SERPINA5 (serpin Peptidase Inhibitor, Clade A (Alpha-1 Antiproteinase, Antitrypsin), Member 5 (SERPINA5))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SERPINA5 est non-conjugé

Application: Western Blotting (WB)

Specificité: SERPINA5 antibody was raised against the C terminal of SERPINA5

Purification: Affinity purified

Immunogène: SERPINA5 antibody was raised using the C terminal of SERPINA5 corresponding to a region with amino acids LPSEGKMQQVENGLSEKTLRKWLKMFKKRQLELYLPKFSIEGSYQLEKVL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SERPINA5 Blocking Peptide, catalog no. 33R-5288, is also available for use as a blocking control in assays to test for specificity of this SERPINA5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SERPINA5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SERPINA5

Antigène: SERPINA5 (serpin Peptidase Inhibitor, Clade A (Alpha-1 Antiproteinase, Antitrypsin), Member 5 (SERPINA5))

Autre désignation: SERPINA5 (SERPINA5 Produits)

Synonymes: anticorps 4933415L04, anticorps PAI-3, anticorps Pci, anticorps PAI3, anticorps PCI, anticorps PCI-B, anticorps PLANH3, anticorps PROCI, anticorps serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 5, anticorps serpin family A member 5, anticorps serine (or cysteine) peptidase inhibitor, clade A, member 5, anticorps plasma serine protease inhibitor, anticorps SPIA5, anticorps SERPINA5, anticorps Serpina5, anticorps LOC480424

Sujet: SERPINA5 belongs to the serpin family. It Inhibits activated protein C as well as plasminogen activators.

Poids moléculaire: 45 kDa (MW of target protein)