Glutaminase anticorps (Middle Region)
-
- Antigène Voir toutes Glutaminase (GLS) Anticorps
- Glutaminase (GLS)
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Glutaminase est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- GLS antibody was raised against the middle region of GLS
- Purification
- Affinity purified
- Immunogène
- GLS antibody was raised using the middle region of GLS corresponding to a region with amino acids VNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQT
- Top Product
- Discover our top product GLS Anticorps primaire
-
anti-Glutaminase (GLS) (AA 516-545), (C-Term) antibody
GLS Reactivité: Humain, Souris, Rat WB, IF, FACS, IHC (p) Hôte: Lapin Polyclonal RB22875 unconjugated
anti-Glutaminase (GLS) (AA 31-253) antibodyGLS Reactivité: Souris WB, IHC, IP, ICC Hôte: Lapin Polyclonal unconjugated
anti-Glutaminase (GLS) (AA 580-669) antibodyGLS Reactivité: Humain WB, ELISA, IF Hôte: Souris Monoclonal 5C4 unconjugated
anti-Glutaminase (GLS) (AA 610-669) antibodyGLS Reactivité: Humain WB, IF Hôte: Lapin Polyclonal unconjugated
anti-Glutaminase (GLS) (AA 221-533) antibodyGLS Reactivité: Humain WB, IHC, IP, ICC Hôte: Lapin Polyclonal unconjugated
anti-Glutaminase (GLS) antibodyGLS Reactivité: Humain, Souris, Rat WB, ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-Glutaminase (GLS) antibodyMicroarray verified GLS Reactivité: Humain, Souris IHC Hôte: Souris Monoclonal MAB601157 unconjugated
anti-Glutaminase (GLS) (C-Term) antibodyGLS Reactivité: Humain, Souris, Rat, Lapin, Chien, Cobaye, Cheval WB Hôte: Lapin Polyclonal unconjugated
anti-Glutaminase (GLS) (AA 616-669) antibodyGLS Reactivité: Humain WB, ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-Glutaminase (GLS) (AA 580-669) antibodyGLS Reactivité: Humain WB, ELISA Hôte: Souris Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GLS Blocking Peptide, catalog no. 33R-9711, is also available for use as a blocking control in assays to test for specificity of this GLS antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLS antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Glutaminase (GLS)
- Autre désignation
- GLS (GLS Produits)
- Synonymes
- anticorps Glut, anticorps RATGLUT, anticorps gls, anticorps si:dz87i4.2, anticorps wu:fa97e05, anticorps GA, anticorps PAG, anticorps AAD20, anticorps GAC, anticorps GAM, anticorps GLS1, anticorps KGA, anticorps AI314027, anticorps 6330442B14, anticorps B230365M23Rik, anticorps CG8772, anticorps CG8872, anticorps Dmel\\CG42708, anticorps Dmel_CG8772, anticorps BA3155, anticorps glutaminase, anticorps glutaminase b, anticorps Glutaminase, anticorps glutaminase kidney isoform, mitochondrial, anticorps Gls, anticorps GLS, anticorps gls, anticorps glsb, anticorps glsA2, anticorps glsA-2, anticorps Arnit_3113, anticorps Celal_2913, anticorps Celly_0289, anticorps Weevi_2101, anticorps Mesop_4683, anticorps LOC100069617
- Sujet
- Sahai demonstrated phosphate-activated glutaminase in human platelets. It is the major enzyme yielding glutamate from glutamine.
- Poids moléculaire
- 73 kDa (MW of target protein)
- Pathways
- Feeding Behaviour, Dicarboxylic Acid Transport, L'effet Warburg
-
