VPS29 anticorps
-
- Antigène Voir toutes VPS29 Anticorps
- VPS29 (Vacuolar Protein Sorting 29 (VPS29))
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp VPS29 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- VPS29 antibody was raised using a synthetic peptide corresponding to a region with amino acids LCTGNLCTKESYDYLKTLAGDVHIVRGDFDENLNYPEQKVVTVGQFKIGL
- Top Product
- Discover our top product VPS29 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
VPS29 Blocking Peptide, catalog no. 33R-4834, is also available for use as a blocking control in assays to test for specificity of this VPS29 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPS29 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- VPS29 (Vacuolar Protein Sorting 29 (VPS29))
- Autre désignation
- VPS29 (VPS29 Produits)
- Synonymes
- anticorps DC15, anticorps PEP11, anticorps 2010015D08Rik, anticorps AW049835, anticorps VPS29, anticorps fb06g05, anticorps wu:fb06g05, anticorps zgc:56191, anticorps zgc:86638, anticorps VPT6, anticorps DDBDRAFT_0188107, anticorps DDBDRAFT_0234192, anticorps DDB_0188107, anticorps DDB_0234192, anticorps vps29, anticorps 17.m07782, anticorps ATVPS29, anticorps MAIGO 1, anticorps VACUOLAR PROTEIN SORTING 29, anticorps VPS29, retromer complex component, anticorps VPS29 retromer complex component, anticorps vacuolar protein sorting 29 homolog (S. cerevisiae), anticorps retromer subunit VPS29, anticorps retromer subunit, anticorps protein involved in endosome to golgi protein transport, anticorps subunit of retromer complex, anticorps metallophosphoesterase domain-containing protein, anticorps VPS29 retromer complex component S homeolog, anticorps vacuolar protein sorting-associated protein 29, anticorps vacuolar protein sorting 29, anticorps Calcineurin-like metallo-phosphoesterase superfamily protein, anticorps vacuolar protein sorting 29 homolog, anticorps retromer complex subunit Vps29, anticorps VPS29, anticorps Vps29, anticorps vps29, anticorps CAALFM_C100320WA, anticorps vps29.S, anticorps ANI_1_150074, anticorps AOR_1_1618194, anticorps CpipJ_CPIJ011219, anticorps MCYG_08523, anticorps PITG_21643, anticorps MGYG_08674, anticorps LOC733048, anticorps cgd7_2060, anticorps PVX_086095, anticorps BBOV_III008970, anticorps CMU_034100, anticorps LOC100281359, anticorps MAG1, anticorps TERG_02857, anticorps Tsp_08912a, anticorps Tsp_08912, anticorps Tsp_08917
- Sujet
- This gene belongs to a group of vacuolar protein sorting (VPS) genes that, when functionally impaired, disrupt the efficient delivery of vacuolar hydrolases. The protein encoded by this gene is a component of a large multimeric complex.
- Poids moléculaire
- 20 kDa (MW of target protein)
-