ART4 anticorps

N° du produit ABIN634060

Détail du produit anti-ART4 anticorps

Antigène: ART4 (ADP-Ribosyltransferase 4 (Dombrock Blood Group) (ART4))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ART4 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: ART4 antibody was raised using a synthetic peptide corresponding to a region with amino acids TLCYEVHYRTKDVHFNAYTGATIRFGQFLSTSLLKEEAQEFGNQTLFTIF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ART4 Blocking Peptide, catalog no. 33R-9161, is also available for use as a blocking control in assays to test for specificity of this ART4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ART4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ART4

Antigène: ART4 (ADP-Ribosyltransferase 4 (Dombrock Blood Group) (ART4))

Autre désignation: ART4 (ART4 Produits)

Synonymes: anticorps ARTC4, anticorps CD297, anticorps DO, anticorps DOK1, anticorps ATR4, anticorps 4432404K01Rik, anticorps Dombrock, anticorps ADP-ribosyltransferase 4 (Dombrock blood group), anticorps ADP-ribosyltransferase 4, anticorps ART4, anticorps Art4

Sujet: ART4 is a protein that contains a mono-ADP-ribosylation (ART) motif. It is a member of the ADP-ribosyltransferase gene family but enzymatic activity has not been demonstrated experimentally. Antigens of the Dombrock blood group system are located on the gene product, which is glycosylphosphatidylinosotol-anchored to the erythrocyte membrane. Allelic variants, some of which lead to adverse transfusion reactions, are known.

Poids moléculaire: 31 kDa (MW of target protein)