Dynamitin anticorps

N° du produit ABIN634073

Détail du produit anti-Dynamitin anticorps

Antigène: Dynamitin (DCTN2) (Dynactin 2 (p50) (DCTN2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Dynamitin est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: Dynactin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ADPKYADLPGIARNEPDVYETSDLPEDDQAEFDAFAQELEELTSTSVEHI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Dynactin 2 Blocking Peptide, catalog no. 33R-1100, is also available for use as a blocking control in assays to test for specificity of this Dynactin 2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DCTN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Dynamitin

Antigène: Dynamitin (DCTN2) (Dynactin 2 (p50) (DCTN2))

Autre désignation: Dynactin 2 (DCTN2 Produits)

Synonymes: anticorps DCTN2, anticorps dctn2, anticorps dctn50, anticorps dynamitin, anticorps rbp50, anticorps CG8269, anticorps DMN, anticorps Dmel\\CG8269, anticorps P50, anticorps dDyn, anticorps dmn, anticorps dyna, anticorps l(2)k16109, anticorps l(2)k16218, anticorps p50, anticorps p50/Dmn, anticorps p50/dynamitin, anticorps 2310042E05Rik, anticorps C130077D06Rik, anticorps C87049, anticorps DCTN-50, anticorps GMP23-48K, anticorps RBP50, anticorps DCTN50, anticorps DYNAMITIN, anticorps zgc:63867, anticorps dynactin subunit 2, anticorps dynactin subunit 2 S homeolog, anticorps Dynactin 2, p50 subunit, anticorps dynactin 2, anticorps dynactin 2 (p50), anticorps dynactin subunit 2 L homeolog, anticorps DCTN2, anticorps dctn2.S, anticorps DCTN2-p50, anticorps dctn2, anticorps Dctn2, anticorps dctn2.L

Sujet: DCTN2 is a 50 kDa subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kDa. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis.

Poids moléculaire: 45 kDa (MW of target protein)

Pathways: M Phase, Ribonucleoprotein Complex Subunit Organization