Cyclin Y anticorps (Middle Region)
-
- Antigène Voir toutes Cyclin Y (CCNY) Anticorps
- Cyclin Y (CCNY)
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Cyclin Y est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Cyclin Y antibody was raised against the middle region of CCNY
- Purification
- Affinity purified
- Immunogène
- Cyclin Y antibody was raised using the middle region of CCNY corresponding to a region with amino acids DENLHPLSKSEVPPDYDKHNPEQKQIYRFVRTLFSAAQLTAECAIVTLVY
- Top Product
- Discover our top product CCNY Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Cyclin Y Blocking Peptide, catalog no. 33R-1914, is also available for use as a blocking control in assays to test for specificity of this Cyclin Y antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCNY antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Cyclin Y (CCNY)
- Autre désignation
- Cyclin Y (CCNY Produits)
- Synonymes
- anticorps CG14939, anticorps Dcyclin Y, anticorps Dmel\\CG14939, anticorps anon-WO0118547.165, anticorps i182, anticorps C10orf9, anticorps CBCP1, anticorps CCNX, anticorps CFP1, anticorps 1700025H17Rik, anticorps 3110050L10Rik, anticorps 4631402G10Rik, anticorps 5730405I09Rik, anticorps RGD1565969, anticorps cyclin Y, anticorps Cyclin Y, anticorps cyclin Y like 1, anticorps CCNY, anticorps CycY, anticorps Ccny, anticorps CCNYL1
- Sujet
- CCNY belongs to the cyclin family, Cyclin Y subfamily. It contains 1 cyclin N-terminal domain. Single nucleotide polymorphism in CCNY gene is associated with Crohn's disease and ulcerative colitis.
- Poids moléculaire
- 39 kDa (MW of target protein)
-